00       00
  
Bug Report
Report an error
  

Populus trichocarpa gene model Potri.016G046600.1
Page views 1


Locus: Potri.016G046600 
Transcript name:  Potri.016G046600.1 
Protein name:  27011919_peptide 
PAC Transcript ID : 27011919 
Chromosome: Chr16 
Start position:  2934205 
End position:  2938021 
Synonyms:  eugene3.00160401;POPTR_0016s04690; 
Description:  similar to KH domain-containing protein; zinc finger (CCCH type) family protein; [ co-ortholog (2of2) of At3g12130, At5g06770, ] 
Best BLAST Aspen Potra001132g09937.1 Potrs019283g21666.1  
Best BLAST ATG AT3G12130.1  
Other transcripts at this locus: Potri.016G046600.2
 
Map Detail Image: 

 


Legend:      5'UTR          CDS          3'UTR               


Genomic Sequence (- strand)        upstream:    downstream:   
>Chr16:2934205-2938021[3817 nucleotides] 
TCTCTCTCTCTCTCTCTCTGAACCCTGCCAGCTTTAGCTGCTTCTCCAAAAGAAAACCCTTATCTGGGGGTGAGGGTTTATGCTCCTGTTTCTGTATCTCTTGTCAGATTCAGGGCGTTAACTCTTTGAGTTCATTACCTAATTGGGATTTTCCAGCTCGTTTTTATTTGGATCTGAGATTTAAATCGATGATGGATACAAGAAAGAGAGGGAGACCTGACTTCGGCACTAATGGTTATGGTGGATTCAAGAAATCTAAGCAAGGTCAGTTCTTTCTCTTAATTTCAATATCCAGCAACTTAATTTCTTTAATTACTATCTGGGTTTTATGTGGTTCATCTTTTTTTAGTGATTTATTTATGCTTTTGATCATTTTATTATTTTTGTCTGGATTTCTATGTCTTAGCTATTAAGAATTTGTTATCTGTACAGTGTTTATTTAAGGAGAAAGTTAGGCTCATACGTTCAAGGAAAAATCTATAATCCTTTGCTTGTTTTAAAATTTAGGTACACGTCAAGAATGGAACTTCTAATCCGAGGAAAAACTGGTTGATTGTTATCTTTGTTGTTTTGTTTTGTTTTGTTTTCTTTCTAAGATGTAATTTATGGTTTTATATTCTTGTTAGAAAGTTTAAAGTATGGTGTCTCGGGGGTTAGCTGGTTAGGCTTTCTTTTACATTGGTTGCAGCTGTAATTTGGCTTGCATGCATGCCTCACCTTTGTTGCTATTTCACTGGTAGGAATTAACCTCATTAGCTTTGATTTTAGTTGTGATTTGCTTGCTTACCCACCTCTTCTGCTCTTTTTTGAATGCTGGCATAGTATTGTCAGGCACTACCTCTAATGTCCTTGTTAAATAAAAAATTTAACTGTCGTTTGTCGTTGAACATGCAAAATTTTTGTCTGGAGAAACCTACATTTATTACAAGTTATACTGTAGGCACCGATATTGTAGCATTCATTTATTGGGTGAAAAGCTGCAAACAGAATACTTCAAACCATGCAAGCACTCAAATTAAATTATCCACAAACTTTAAGAACAGTTTCTCATTATCAAAAGATTGCCCGTTATTTGAGTAATATAATGTATTATATTAACCCAATCATCCTTCAATGACTTTGAGAGATTTTTGGTTTTTCCTCAAACTCACTTTTGTTACATATTTGTAAAATCACCAAACATAACTAACAATATACAGCTTCAAACACAAATACATTTGGCCAAACAAAAACCAAATCATCTCCAAGCATCAATTAAACATGCCCTGAACAAAGTGAAACTCACAACAAAAACAACAACACCCATAAACTTCATTGGAGACTTTGGTTTACTGATTAAGTAAAAAAACGGTGACAGGGTTACCCATATAAGTGGATGCTACATAAGGGTGAAAAATTTGTTGGAATGTAATTGTCAATGTACATCTCTCATTATGCCTTATGCATTCTTTATGTTAGTTGGACAATTTTATTTAAAGAGCTTCAGTTTTTGTAGGGAATACTACTAGTATTAAACTTGGGAATATTCTAGACTAAGCAGATTAAGAATCTGGAAATCTTTTAACTAAGAACAAGTAATTAATGCTTGTAACAGAAATGGACTCCTTATCAACTGGTGTAGGAAGCAAATCGAAGCCATGCACCAAGTTTTTCAGGTTCAAATCTTCTCACCTAAATAAGTATCTTGAATTTCATCTTTTATCCTTTAATATTTAGAAGTTACTGTAAATTTTTATTTATTTTTTATTTCACAATATAAGTTATGTACTGCCCTAATGAAGTGGGTATTTAGCTGTTATACAGGTCCTTAAACATACCTGTGCTTTGTTCAAATGAAGTTAATTAATGGAATTTCATTAGAGACTTTGGTTTACTATTGAACTACAAAAAAGATAATTGCTTGCTGGAATACAGTTGACGCTAAGACAGTTATTTGAAGATTGATATTATTTTTATACCAAGGAATGCCTTCTGGCTGTCCCTGCTTCTCTAACAACAGTAATATTTAACATTAGCTTCAGCTATTGAACCCACTTCCTGTTGATAAATGTGGAATCTGTTAAGATAAATCTCAGGTATGATGCCAGAAATTTCGAATAAAGGATTTTGCTGACATGGACTTGTATTATTATAGCAGCAAGTTCTATTTTTATAGATTTGTATCAGTTTGTGATCGCTATGTTATTAGTCATGCCACTGAAGTTTATGCTATGCTATCTTCTAGTCAATGATAAAGTTAACAGTTTGGAGTCTTGTTACCTTAGCATGTCATCACGTTATGGAATCTCAGTTTAATTGCATCAGCTATTTCCCTTATTTCTGGTTATAACAGAATTTTGACATGGAATTTCATTTTTATAGGAGGTAGCGTGTTCTGCTTTCATTCCCGATATTTGGGGATGCTGTTATACAGCATTCATCATGTGAACCTGCATTATTATCAGAGTTAATTGCCTTTTGGTTATGTGTGCAGTCGATAGTTAGAAGAATAAGCTTGTAGTCAAGCATTTCAATCTTTTTTAATTGTCAAGTGATAGTTGCAGGCCTTAATTGTTCAATTAGTATTTAGCTTTTAGATGAAGTACTTTTTTGACTGTTAAGCAGTGTCATTTATTTTACTTTTATAAATGGTGGATTGACTTGCAGAACTGATTTCTTCTTTTTCCTTGGTTATGCATTGGATTGCAGTACTGCTGGCTGTCCATTTGGCGAGAGCTGCCACTTTCTCCACCATGTTCCCGGTGGCTACAAGGCTGTGGCCCAGATGGTGAATCTGGGACCTACTGTTGCTTTACCGCCTGTACCTAACAGCTCTGCTCCGTCTGCTGTTAAAAGCCGGCTATGCAAAAAATACAATAGTGCTGAAGGTTGCAAATTTGGTGATAAATGCCATTTTGCGCATGGCGAGTGGGAACTTGGCAAGGCTTTTGTTCCATCCCACAACGATCCTCATGCTGCTGGAAGTGTTCCAGGACGTCTGGGTGGTCGGGTGGAGCCACCCCCTCCTGGCCCCGCCACCAGCTTCGGTGTCTTTGCCACCACTACAAGAATCAGTGTAGATGCCTCCCTTGCTGGATCCATCATTGGTAAGGCTGGTGTGCATTCCAAGCAGATCTGCCGCCAAACAGGAATCAAGCTATCTATTAAGGATCATGAAACAAATCCAAATCTCAAGAACATTGAGCTAGAGGGGTCTTTGGAACAGATTGCCCAAGCTAGTAAGATGGTAGAAGAGCTTGTGAGGGTGACTTCAGCAAATGCCGCTGCAAAATCCTCTGGGGGTCATGCCAACCCAGGAAGCAACTATAAGACTAAGTTGTGTGACAATTTTGCCAAAGGGTCTTGCACTTTTGGTCAAAGGTGCCATTTTGCTCATGGGGCTGCTGAATTGCGCAAGTCATCAGTGTGAGTGGACTCTTCAGTTTTCCTAGTTAGTTTATGGCTTTAGCTGTCGTGCAGCCTTTGTATGAGTGAGCTCTATTTTAGTTCTGGCTGTGCAATGGTACCTAGCGAGAGAAAATTATGATCTTACTTTTTTGGGGCTTCTTGTATACTTTTTAGAACTATCATAGCTTTAGCTTCCAATCTTCCTCAATTTTATGTATCATACTCTGCCAGCTTGTCGATGCTGAACCTGGATTTATGTTTCCGAGTAGATAATAATAGGCTTGTCTAATTTGCTAGAAACCCTGGACTTTTGTATGTTATGACATTACTTTCTCAAAAGACTTGTATTGCAAACTGCAATTCTTCTGTTTCACACTCCAAAGCCTTCGAATTATTCAATGGCTATTTCTACCTGATCATTACCAGGTGC
   


CDS sequence:
>Potri.016G046600.1[858 nucleotides] 
ATGATGGATACAAGAAAGAGAGGGAGACCTGACTTCGGCACTAATGGTTATGGTGGATTCAAGAAATCTAAGCAAGAAATGGACTCCTTATCAACTGGTGTAGGAAGCAAATCGAAGCCATGCACCAAGTTTTTCAGTACTGCTGGCTGTCCATTTGGCGAGAGCTGCCACTTTCTCCACCATGTTCCCGGTGGCTACAAGGCTGTGGCCCAGATGGTGAATCTGGGACCTACTGTTGCTTTACCGCCTGTACCTAACAGCTCTGCTCCGTCTGCTGTTAAAAGCCGGCTATGCAAAAAATACAATAGTGCTGAAGGTTGCAAATTTGGTGATAAATGCCATTTTGCGCATGGCGAGTGGGAACTTGGCAAGGCTTTTGTTCCATCCCACAACGATCCTCATGCTGCTGGAAGTGTTCCAGGACGTCTGGGTGGTCGGGTGGAGCCACCCCCTCCTGGCCCCGCCACCAGCTTCGGTGTCTTTGCCACCACTACAAGAATCAGTGTAGATGCCTCCCTTGCTGGATCCATCATTGGTAAGGCTGGTGTGCATTCCAAGCAGATCTGCCGCCAAACAGGAATCAAGCTATCTATTAAGGATCATGAAACAAATCCAAATCTCAAGAACATTGAGCTAGAGGGGTCTTTGGAACAGATTGCCCAAGCTAGTAAGATGGTAGAAGAGCTTGTGAGGGTGACTTCAGCAAATGCCGCTGCAAAATCCTCTGGGGGTCATGCCAACCCAGGAAGCAACTATAAGACTAAGTTGTGTGACAATTTTGCCAAAGGGTCTTGCACTTTTGGTCAAAGGTGCCATTTTGCTCATGGGGCTGCTGAATTGCGCAAGTCATCAGTGTGA
   

Transcript sequence:
>Potri.016G046600.1[1454 nucleotides] 
TCTCTCTCTCTCTCTCTCTGAACCCTGCCAGCTTTAGCTGCTTCTCCAAAAGAAAACCCTTATCTGGGGGTGAGGGTTTATGCTCCTGTTTCTGTATCTCTTGTCAGATTCAGGGCGTTAACTCTTTGAGTTCATTACCTAATTGGGATTTTCCAGCTCGTTTTTATTTGGATCTGAGATTTAAATCGATGATGGATACAAGAAAGAGAGGGAGACCTGACTTCGGCACTAATGGTTATGGTGGATTCAAGAAATCTAAGCAAGAAATGGACTCCTTATCAACTGGTGTAGGAAGCAAATCGAAGCCATGCACCAAGTTTTTCAGTACTGCTGGCTGTCCATTTGGCGAGAGCTGCCACTTTCTCCACCATGTTCCCGGTGGCTACAAGGCTGTGGCCCAGATGGTGAATCTGGGACCTACTGTTGCTTTACCGCCTGTACCTAACAGCTCTGCTCCGTCTGCTGTTAAAAGCCGGCTATGCAAAAAATACAATAGTGCTGAAGGTTGCAAATTTGGTGATAAATGCCATTTTGCGCATGGCGAGTGGGAACTTGGCAAGGCTTTTGTTCCATCCCACAACGATCCTCATGCTGCTGGAAGTGTTCCAGGACGTCTGGGTGGTCGGGTGGAGCCACCCCCTCCTGGCCCCGCCACCAGCTTCGGTGTCTTTGCCACCACTACAAGAATCAGTGTAGATGCCTCCCTTGCTGGATCCATCATTGGTAAGGCTGGTGTGCATTCCAAGCAGATCTGCCGCCAAACAGGAATCAAGCTATCTATTAAGGATCATGAAACAAATCCAAATCTCAAGAACATTGAGCTAGAGGGGTCTTTGGAACAGATTGCCCAAGCTAGTAAGATGGTAGAAGAGCTTGTGAGGGTGACTTCAGCAAATGCCGCTGCAAAATCCTCTGGGGGTCATGCCAACCCAGGAAGCAACTATAAGACTAAGTTGTGTGACAATTTTGCCAAAGGGTCTTGCACTTTTGGTCAAAGGTGCCATTTTGCTCATGGGGCTGCTGAATTGCGCAAGTCATCAGTGTGAGTGGACTCTTCAGTTTTCCTAGTTAGTTTATGGCTTTAGCTGTCGTGCAGCCTTTGTATGAGTGAGCTCTATTTTAGTTCTGGCTGTGCAATGGTACCTAGCGAGAGAAAATTATGATCTTACTTTTTTGGGGCTTCTTGTATACTTTTTAGAACTATCATAGCTTTAGCTTCCAATCTTCCTCAATTTTATGTATCATACTCTGCCAGCTTGTCGATGCTGAACCTGGATTTATGTTTCCGAGTAGATAATAATAGGCTTGTCTAATTTGCTAGAAACCCTGGACTTTTGTATGTTATGACATTACTTTCTCAAAAGACTTGTATTGCAAACTGCAATTCTTCTGTTTCACACTCCAAAGCCTTCGAATTATTCAATGGCTATTTCTACCTGATCATTACCAGGTGC
   

Protein sequence:
>Potri.016G046600.1[285 residues] 
MMDTRKRGRPDFGTNGYGGFKKSKQEMDSLSTGVGSKSKPCTKFFSTAGCPFGESCHFLHHVPGGYKAVAQMVNLGPTVALPPVPNSSAPSAVKSRLCKKYNSAEGCKFGDKCHFAHGEWELGKAFVPSHNDPHAAGSVPGRLGGRVEPPPPGPATSFGVFATTTRISVDASLAGSIIGKAGVHSKQICRQTGIKLSIKDHETNPNLKNIELEGSLEQIAQASKMVEELVRVTSANAAAKSSGGHANPGSNYKTKLCDNFAKGSCTFGQRCHFAHGAAELRKSSV
   



GO ID Description
Loading data from server


PFAM ID
Loading data from server


PANTHER ID
Loading data from server


KO ID
Loading data from server


EC ID
Loading data from server


KOG ID
Loading data from server


Type Probe Name
Loading data from server


Data generated by



PlantGenIE GeneLists

Species Name Genes
Amborella trichopodascaffold00022.187; scaffold00149.35; scaffold00269.3;
Arabidopsis thalianaAT5G06770; AT3G12130;
Oryza sativa ssp. japonicaOS04G57010; OS06G41384; OS02G10080;
Oryza sativa ssp. japonicaOL17G00170;
Physcomitrella patensPP00059G01660; PP00066G01040;
Picea abiesMA_159838g0010; MA_68032g0010; MA_1151g0010; MA_83924g0010; MA_8414656g0010;
Pinus taedaPITA_000059887-RA; PITA_000014089-RA; PITA_000014090-RA; PITA_000059827-RA; PITA_000005455-RA; PITA_000088084-RA; PITA_000031774-RA; PITA_000005456-RA; PITA_000032900-RA; PITA_000066266-RA; PITA_000087140-RA; PITA_000057922-RA;
Populus trichocarpaPotri.016G046600; Potri.001G013200; Potri.003G213200; Potri.T111100; Potri.006G191900;
Selaginella moellendorffiiSM00000G10060;
Vitis viniferaVV06G06800; VV08G09280; VV13G00710;
Zea maysZM02G01270; ZM10G25850; ZM04G38270; ZM06G13250; ZM09G15400; ZM01G39120; ZM06G11100;

No submitted publication available for this gene(Potri.016G046600).


Map Image: 
Login | Site Map | © 2021 PlantGenIE.org.| All our tools are under MIT License


  • GeneList
      view active genelist () here.
      genelist namegenesrenamedelete
      add empty genelist / save current list / cancel
  • Analysis
  • <