00       00
  
Bug Report
Report an error
  

Populus trichocarpa gene Potri.006G191900
Page views 1


Locus: Potri.006G191900 
Transcript name:  Potri.006G191900.1 
Protein name:  27006440_peptide 
PAC Transcript ID : 27006440 
Chromosome: Chr06 
Start position:  20669673 
End position:  20672915 
Synonyms:  gw1.VI.615.1;POPTR_0006s20620; 
Description:  similar to KH domain-containing protein; zinc finger (CCCH type) family protein; [ co-ortholog (1of2) of At3g12130, At5g06770, ] 
Best BLAST Aspen  
Best BLAST ATG  
Other transcripts at this locus:  
Map Detail Image: 

 


Legend:      5'UTR          CDS          3'UTR               


Genomic Sequence (+ strand)        upstream:    downstream:   
>Chr06:20669673-20672915[3243 nucleotides] 
ATGGATACAAGAAAGAGAGGGAGGCCTGACTTCAAAACTAATGGCTTTGGTGGATTCAAGAAATCTAAGCAAGGTCACCTATTTCTCTTAATCTCAAGATTTAGCCAGTTAGTTTCTTTAACTGGTATCTGGGCTTTTCATGTTGTTTGGTTTTCTTTTGGTGTTTTACTGATTTGTTTATGCTTTAAGTATGTTTTTAACTGTTTGTCGATTTATGCGTCTTAGCTTTTAAGAATTTGTTAGCTTGCACGGTGTTTTAAGGGAGAATTTAGCCTCAAGTGTTCTTTGTGTGTCTGTTTGGTTTCCAAGGCTAAATTTTTAATCATTTTCGTGTTTTAAAATTTGGGTCAATGCCAAGAATGAAGCTTTTATTCCGTGGAAAGATTGGTTGACTGTTATCTTTACTGTTTTGTTCTTTTTGGATTTTTTTTTTACATAATTTATGCTTCTATATTTTTGTTAGAATGTTTAAATTATGTTGTTTTGGGGGTTAGCTGGTTAGGCTTTTTTTTTTTTTACGTTGGTTGTAGTTGTGATTTTGCCTGCTTGTATGTCAAACCTTTGCTGCTGTTTCACTGGTAGGACTGTAGAGTCAGGAATTACCCGCATTAGCTTTGATTGAAGTTATGATTTTCTTGCTTATCCCACTTCTTCTGCTGCTGCTGCTTGAATATTGGCATAATAGTTTCAGAAACTACCTCATTGGTTGGTGTCCTTGAGAATTCAAATTTTTAAACTGTCGTTGAACATGCAAAATCTTAGCCTGGAGAAACTTTACCTGTGTTACAAGTTATACTTAAAGCACTGATAATGTAGCATTCATTTATAGGGTGAAAAGGCTGCAAATAAAACACTTCAAACCATACAAACACTCAAATTGAATTATCCCCAAAGCTCAAGAACTGTTACTCATCGTCAAAAGATTGTCCTTTGTTTGAGTAATATATTTTATAGAATTAACCCAAGCATCCTTCAATGGCTTTGAGAGAGATTTCTGGTTTCTCCTCTAAACATAACTAACATCAAACAGCCTCAAATATAAATGCATTTGGCCAAACAAAAATCAAATCATCTCCCAGCATTTAACTTCACCTCAATTAAACATGCCCTGAACTAAGTGAAAATCTCAACAAAACAAAAACACCCATAAACTTCATTGGAGACTTCAGTTCACCTGTGAAGTAAAAAAACAGGGTTACCCATATGAGTGGATGCTACATAAGGGTGAGAAAAATTTGCTGGAATGTACTTGTCAATGTACATCTATATTATGCACTATGCATTCTATATTAGTTAGACAATTTTATTCTAAAAAACTTTGGTGTTTTGTAGTGAATCCTACTGGTATTAAACTTGGGAATATTCTAGAATAAGTAGATTAAGAATCTGGAGAAATTTTAACTGAGAACAAGTAATTAATGTTTGTAACAGAAATGGACCCCTTATCAACTGGTGTAGGAAGCAAATTGAAGCCATGCACCAAGTTTTTCAGGTTCAAATTTTCTCACCTAAATAAGTATCTTGAATTTCATCCTTTATCTTTTAATATTTAAAAGTTACTGTAATTTTTTTCCCACAATTTAAGTTGTGTACTGTGCTAATGAAGTGGGTATTCTAGCTGTTATACAGGTACTTAGTCATATCTGTGCTTTGTTCAAACAAAGTTAATTAATGGAATTTCATTGGAGACTTTGTTTTACTTATGAACTACAAAAAAAGATAATTGCTTGCTGGAAAACAGTTGATGTAAGACTTTTTTTTTTTCCTGGATATTGATTTTATTTTTATACCCAAGGAATGTCATCTGGCTTTCCTTGCTACTTTAACAACAATAACATTTAATGTCATTTTTTCCATTTTAAAGTTTATTGGTTCTGGATTGAACACAACTTCCTATTAAATAAATTAGATTATGTTGAAGTAAGTTAAACTTTCAGTATGGTGTCAAAAATTTAGAATAATGGATTTGCTGGCACAGACTTGTATTACTGTAGCAGCAAGTTCAATTATCTGTGATGAAGTTTATGCTGTGCTATCTTCTAATCTGTGATGAAGGTATTCCAGTTTGGAGTCTTGTTGCCTTAGTTCATTGGTATAATGGAGTCTTAGTTTAACATCACTTCAGCTGTGTTCCTTATTTCTGGTCCTAACAGAATTTTGATTCAGTATTTCATTTTTCTAGGTGGTAGCCTATTCTGCTTTCATTCCCAATAAGTTGGAGATGATGTTATACAGAATTCATCATGTGAATCTGCATTTTTATCAAAGTCAATTGCTTTGTGGTTATCATCTGCAGTTGATAGTTAGAAGAATAAGATTGTAGACGAGCATTTCAATCTTTTTTAATTAAATGATAGTTGTAGACCTTAATTGTTTGATTAGTATTCAGCTGCTAGATGTACTTTTGGACTTTTAAGCAGTATCATTTATTTGCACATGGTGGATTGACTTAACTGAATTTTTTTTTTGGTTATGCTTTGGATTGCAGCACTGCTGGCTGCCCATTTGGTGAGAGCTGCCACTTTCTCCACCATGTTCCTGGTGGCTACAATGCTGTGACCCAGATGATGAATCTGGGACCTACTGTCACCCCACCATCCAGAAGTATGGTGGCCCCACTGCCAGTCCCTAATGGCTCTGCTTCGTCTGCTGTTAAAGGCCGGCTATGTAACAAATACAGTAGTGCTGAAGGTTGCAAATTTGGTGATAAATGCCGTTTTGCGCATGGTGAGTGGGAACTTGGCAGGGCTTTTGCTCCATCTCACAACAATCCACGTGCTGCTGGAGGTGTTCCAGGACATTTGGGTGGTCGTGTGGAGCAACCTTCTCCTGGCCCTGCTACCAGCTTTGGTGTCTTTGCCACCACTACAAGAATCAGTGTCAATGCCTCCCTTGCTGGATTCATCATTGGTAAGGGTGGTGTGCATTCCATACAGATATGCCACCAAACAGGAGTCAAGCTGTCTATTAAGGAGCATGAAACAAATCCAAATCTCAAGAACATCGAACTTGAGGGGTCATTTGAACAGATTGCCCAAGCTAGCAAGATGGTAGAAGAGCTTGTAAAGGTGAATTCAGCAAAAGCCGCTGCAAAAACCTCTGGGGGCCGTGGGGGGCATGCCAATCCAGGAAGCAACTATAAGACCAAGTTGTGTGACAATTTTGCCAAAGGGTCTTGCACTTTTGGTCAAAGGTGCCATTTTGCTCACGGAGCTGCTGAATTGCGCAAGACAGCAGCGTGAG
   

CDS sequence:
>Potri.006G191900.1[705 nucleotides] 
ATGGATACAAGAAAGAGAGGGAGGCCTGACTTCAAAACTAATGGCTTTGGTGGATTCAAGAAATCTAAGCAAGAAATGGACCCCTTATCAACTGGTGTAGGAAGCAAATTGAAGCCATGCACCAAGTTTTTCAGCACTGCTGGCTGCCCATTTGGTGAGAGCTGCCACTTTCTCCACCATGTTCCTGGTGGCTACAATGCTGTGACCCAGATGATGAATCTGGGACCTACTGTCACCCCACCATCCAGAAGTGTTCCAGGACATTTGGGTGGTCGTGTGGAGCAACCTTCTCCTGGCCCTGCTACCAGCTTTGGTGTCTTTGCCACCACTACAAGAATCAGTGTCAATGCCTCCCTTGCTGGATTCATCATTGGTAAGGGTGGTGTGCATTCCATACAGATATGCCACCAAACAGGAGTCAAGCTGTCTATTAAGGAGCATGAAACAAATCCAAATCTCAAGAACATCGAACTTGAGGGGTCATTTGAACAGATTGCCCAAGCTAGCAAGATGGTAGAAGAGCTTGTAAAGGTGAATTCAGCAAAAGCCGCTGCAAAAACCTCTGGGGGCCGTGGGGGGCATGCCAATCCAGGAAGCAACTATAAGACCAAGTTGTGTGACAATTTTGCCAAAGGGTCTTGCACTTTTGGTCAAAGGTGCCATTTTGCTCACGGAGCTGCTGAATTGCGCAAGACAGCAGCGTGA
   

Transcript sequence:
>Potri.006G191900.1[706 nucleotides] 
ATGGATACAAGAAAGAGAGGGAGGCCTGACTTCAAAACTAATGGCTTTGGTGGATTCAAGAAATCTAAGCAAGAAATGGACCCCTTATCAACTGGTGTAGGAAGCAAATTGAAGCCATGCACCAAGTTTTTCAGCACTGCTGGCTGCCCATTTGGTGAGAGCTGCCACTTTCTCCACCATGTTCCTGGTGGCTACAATGCTGTGACCCAGATGATGAATCTGGGACCTACTGTCACCCCACCATCCAGAAGTGTTCCAGGACATTTGGGTGGTCGTGTGGAGCAACCTTCTCCTGGCCCTGCTACCAGCTTTGGTGTCTTTGCCACCACTACAAGAATCAGTGTCAATGCCTCCCTTGCTGGATTCATCATTGGTAAGGGTGGTGTGCATTCCATACAGATATGCCACCAAACAGGAGTCAAGCTGTCTATTAAGGAGCATGAAACAAATCCAAATCTCAAGAACATCGAACTTGAGGGGTCATTTGAACAGATTGCCCAAGCTAGCAAGATGGTAGAAGAGCTTGTAAAGGTGAATTCAGCAAAAGCCGCTGCAAAAACCTCTGGGGGCCGTGGGGGGCATGCCAATCCAGGAAGCAACTATAAGACCAAGTTGTGTGACAATTTTGCCAAAGGGTCTTGCACTTTTGGTCAAAGGTGCCATTTTGCTCACGGAGCTGCTGAATTGCGCAAGACAGCAGCGTGAG
   

Protein sequence:
>Potri.006G191900.1[234 residues] 
MDTRKRGRPDFKTNGFGGFKKSKQEMDPLSTGVGSKLKPCTKFFSTAGCPFGESCHFLHHVPGGYNAVTQMMNLGPTVTPPSRSVPGHLGGRVEQPSPGPATSFGVFATTTRISVNASLAGFIIGKGGVHSIQICHQTGVKLSIKEHETNPNLKNIELEGSFEQIAQASKMVEELVKVNSAKAAAKTSGGRGGHANPGSNYKTKLCDNFAKGSCTFGQRCHFAHGAAELRKTAA
   



GO ID Description
Loading data from server


PFAM ID
Loading data from server


PANTHER ID
Loading data from server


KO ID
Loading data from server


EC ID
Loading data from server


KOG ID
Loading data from server



PlantGenIE GeneLists

Species Name Genes
Amborella trichopodascaffold00022.187; scaffold00149.35; scaffold00269.3;
Arabidopsis thalianaAT5G06770; AT3G12130;
Oryza sativa ssp. japonicaOS04G57010; OS06G41384; OS02G10080;
Oryza sativa ssp. japonicaOL17G00170;
Physcomitrella patensPP00059G01660; PP00066G01040;
Picea abiesMA_159838g0010; MA_68032g0010; MA_1151g0010; MA_83924g0010; MA_8414656g0010;
Pinus taedaPITA_000059887-RA; PITA_000014089-RA; PITA_000014090-RA; PITA_000059827-RA; PITA_000005455-RA; PITA_000088084-RA; PITA_000031774-RA; PITA_000005456-RA; PITA_000032900-RA; PITA_000066266-RA; PITA_000087140-RA; PITA_000057922-RA;
Populus trichocarpaPotri.016G046600; Potri.001G013200; Potri.003G213200; Potri.T111100; Potri.006G191900;
Selaginella moellendorffiiSM00000G10060;
Vitis viniferaVV06G06800; VV08G09280; VV13G00710;
Zea maysZM02G01270; ZM10G25850; ZM04G38270; ZM06G13250; ZM09G15400; ZM01G39120; ZM06G11100;


Methods of the gene family analysis can be found here.

No submitted publication available for this gene(Potri.006G191900).


Map Image: 
Login | Site Map | © 2021 PlantGenIE.org.| All our tools are under MIT License


  • GeneList
      view active genelist () here.
      genelist namegenesrenamedelete
      add empty genelist / save current list / cancel
  • Analysis
  • <